DPCstruct | MC3938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 713 |
|---|---|
| Mean domain length (aa) | 153 ± 35 aa |
| Standard deviation of domain lengths | 35.35 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.15 |
| Pfam Score | 96.82 |
| Assigned Pfam label(s) | PF14903- CL0508- CL0159- CL0694- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0SB26 | 2-94 | ILLNQAWYYLKSDGSYAKNAWQGAYYLKSNGKMAQGEWVYDSSYQAWYYLKSDGSYARNAWQGNYYLKSDGKMAKNERVDGGRYYVD… |
| K1A3Y0 | 19-162 | DGYKWLGYLSYSGSRRYVKYEKLSNTENGWKKEGGSWYYQENGKLATGWKKVNSNWYHLKENGAMSTGWIKDGSHWYYLKASGEMQT… |
| A0A2B2BUE6 | 95-280 | None |
| J5GZW5 | 25-136 | None |
| J5GEA6 | 5-131 | None |
| A0A412IX55 | 401-577 | None |
| A0A412IXV5 | 834-996 | None |
| A0A847J4E3 | 42-140 | None |
| A0A2C1BTY2 | 106-206 | None |
| A0A251WV52 | 167-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.