DPCstruct | MC39375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 17.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6QVB5 | 308-426 | AAGAWMFNGCLQVLNTGLVPGNRNADNVDPIMEKFDYIVYPNRSLQTDGIKAFSVTSFGFGQKGAQAIGIHPKYLFATLDQAEFSRY… |
| A0A3D1EIF3 | 1-135 | MAPAGGDQLSAILGAWSDGWVPGIKTIDHIADDVHHEHLQLPFQDVEIDPAQMPGAFINSKGFGGNNATGFVLSPAFTLGMLAKRWG… |
| H0EC83 | 733-859 | None |
| A0A1Y1VY13 | 103-243 | None |
| A0A1Y1WKJ8 | 2-122 | None |
| F2RWE9 | 330-440 | None |
| A0A6P8ATJ1 | 344-476 | None |
| A0A7S0K2I8 | 248-406 | None |
| A0A7S1JPU8 | 1-139 | None |
| A0A3D3DT06 | 33-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.