DPCstruct | MC3937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 12.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370TZD2 | 19-152 | IPPSAGAALRNYTIAVPDGTTNHGDPDLLCMPPSWTDIFIFYAANYFAHAATVISRPGETTINSAVTIVSALLFPISGVVRGVSAIV… |
| A0A0C3HLK4 | 1-136 | MMAMPAIAINNSTFTIPEGGTNHGNPNLLYTPTKWTDIVVFILGNCVAHAATVKVGSGFSAAFASYLMLGALLVPTVGILRGIEAII… |
| A0A4S9NYJ4 | 4-146 | None |
| A0A2T3ZP18 | 1-114 | None |
| L2FH58 | 6-155 | None |
| A0A6A5WFC6 | 27-140 | None |
| A0A178AC86 | 1-128 | None |
| A0A4S2N1N3 | 46-165 | None |
| A0A0B8N3W3 | 24-141 | None |
| A0A8A3PCT0 | 2-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.