DPCstruct | MC39350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 164 ± 29 aa |
| Standard deviation of domain lengths | 28.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 32.44 |
| Pfam Score | 86.90 |
| Assigned Pfam label(s) | PF01594- PF00958- CL0288- CL0039- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162DC45 | 70-233 | EQQYIDYVRLAPQVNPTPVRRVLGRELGLPAELLERHPFPGPGLSIRIIYAGELFMEADFGETQVLIRLMVDYANMAAKDHVLLNRI… |
| A0A7R9N1R0 | 6-156 | IEPLRELFKDEVRILARELGLPEVIIKRQPFPGPGLAIRIIGEVTPQRLSILRKADKIVLEEMRKANLYDTVWQSFAILLPIKTVGV… |
| A0A6N3E8N6 | 75-230 | None |
| T5BFW6 | 373-543 | None |
| A0A183SQ05 | 454-598 | None |
| A0A821R3T0 | 191-405 | None |
| U6LUF5 | 1-162 | None |
| A0A1V6HR44 | 66-173 | None |
| A0A158QY68 | 346-561 | None |
| Q7VG78 | 1202-1375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.