DPCstruct | MC3935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 21.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3H2Z8 | 2-119 | STTKPPSAQRPSSPTFTPSMQDAQARNKDPYALSSDSESESSSRYDAYGNDTYEAIQLRREAAVVLDTPELLMMHAQARGDSIPATR… |
| A0A177CJD8 | 1-101 | MPHNQQYFKTMLNSNSPAQFTDAQRSQQARGKSYATKAAGEPYEARAKREQAAQILESVELLVWHSNARNESVAQTRQHFQNIMLGL… |
| A0A6G1IKZ6 | 58-194 | None |
| A0A2H4SG50 | 2-162 | None |
| M1W1Q2 | 2-114 | None |
| Q2GPA9 | 2-178 | None |
| A0A178ALD7 | 26-171 | None |
| A0A0A1TEF2 | 2-147 | None |
| A0A4Z1FZV3 | 60-204 | None |
| J3PLB8 | 44-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.