DPCstruct | MC39349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 157 ± 30 aa |
| Standard deviation of domain lengths | 29.79 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.05 |
| Pfam Score | 80.95 |
| Assigned Pfam label(s) | PF01288- PF12626- PF12627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2BZ26 | 2-90 | NDILDEQCRTIAIPKRITTTMRDIWQLQQRLPKRQGRRANKLLEHPKFRAAFDLLELRANVQRNPDLEALAAWWADFQVFKQYTTTL… |
| A0A162CYP6 | 11-161 | LERWNRLREAGEPVVPALQQAIDTVFDARIGDISGRGKLATDMREIWMMQPRFERRSGSGVYTLIEQPRYRAGFDFLRLRADAGEIE… |
| A0A6A5KZM9 | 300-439 | None |
| A0A3B8WYY9 | 23-191 | None |
| A0A6D2GC21 | 325-504 | None |
| A0A090PJ36 | 5-137 | None |
| A0A2X1YI00 | 34-185 | None |
| A0A485B3E4 | 184-327 | None |
| A0A2S9RE15 | 1-113 | None |
| A0A3S4FBS7 | 7-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.