DPCstruct | MC39347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 187 ± 14 aa |
| Standard deviation of domain lengths | 13.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9FK81 | 56-253 | APKLYYIADHSFYCIELFEYKYYLLVKAMLNGIIENNPLSLANNCRSLLEQVATLACCMNAVEKMLDELKGQGDLDKINKIISNAEL… |
| F3LSF0 | 1-192 | MLTLRSKLPFTALSIREVLFYRVAHLATAAVALYERNDYLGGVILTRSVIETVALSSAVERALNRFLRVRNKEALHRYLMQVLLARG… |
| A0A7J3RXH7 | 75-279 | None |
| A0A849HZH9 | 197-384 | None |
| A0A352H6V1 | 1-172 | None |
| A0A5M6IZL5 | 113-300 | None |
| A0A5S3V7B4 | 41-231 | None |
| X6CMT6 | 2-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.