DPCstruct | MC39338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0139- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287TQ77 | 93-157 | KMYLEEEQIFRIDHYLGKELVENLSVLRFSNLVFQPLWSRDYIRNVQLIFSEDFGTEGRGGYFDN |
| A0A5N9H9T4 | 1-68 | MAQVFDESQVYRIDHYLGKEMVQNLLVFRFANAIFELVWNRNDIDSVQITVAERIPVLDRGGYDDHSV |
| A0A4U1FD16 | 22-93 | None |
| A0A0M2NQV9 | 67-144 | None |
| A0A422NHS1 | 74-138 | None |
| A0A821QJT8 | 188-261 | None |
| G0QIE2 | 145-217 | None |
| A0A7R9LGE2 | 261-325 | None |
| A0A835PNF2 | 95-159 | None |
| A0A674JTE6 | 199-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.