DPCstruct | MC39336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N9H415 | 32-103 | PKGRAFVTGVGIIGPVNSVIGSDVGVVVGRFLTGMPKRLAVADGPSIMNSVLIDVSDDGTATSIERVDREVD |
| A0A7V9HQI2 | 89-168 | HTHVPTADARVLPAGTAFICDVGMTGSRTSILGVEVEDALGRFQTQMPTRFRTAEEDVWINAVVIDIGADGRATSIEQVL |
| A0A3B0PBN9 | 91-178 | None |
| A0A7V0JI68 | 118-198 | None |
| A0A1H7Z557 | 1-62 | None |
| A0A257LSG2 | 286-361 | None |
| A0A2D9QTQ6 | 68-151 | None |
| A0A538LC21 | 335-417 | None |
| A0A835G0X5 | 381-465 | None |
| A0A7X7TYA9 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.