DPCstruct | MC39331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 220 ± 43 aa |
| Standard deviation of domain lengths | 42.91 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835KWP6 | 83-276 | KKELPSESVPGLGFKDKEAAEGTLKELEGRDPDYQRLAVKGLIGRAKRVLTCTRDETKIANIKEAMAIFEKFLDDFESLHLSKQNNP… |
| D6WAA7 | 7-197 | DTVPGLGFKDKEKALETIKNLEGRDPDYQKLAIKGLIGRAKRTLTLTKDKEKLQNINDAMAVFDEWLNNFEKNGLTKENRAYLPLNA… |
| A0A3M6Z2I9 | 3-275 | None |
| A0A0L7L498 | 32-193 | None |
| A0A653C2C1 | 1-174 | None |
| A0A3L8E400 | 489-742 | None |
| A0A834N8S9 | 203-438 | None |
| A0A2H1VJ50 | 87-324 | None |
| A0A6A6WIB4 | 58-276 | None |
| A0A7R8VD26 | 4-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.