DPCstruct | MC3933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Standard deviation of domain lengths | 19.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4MDM7 | 10-113 | SALHVANVTCPTCRCFTINDEPNPDLKSGKRVRIWDSCHFLSFTRVASGEVFRRDRPSRFKQRIYHKFVYSIIGSISCVGCGRCVEV… |
| A0A7J4G1I1 | 156-277 | LEKKIEKKFNAKIWEKYFKSCLSCSACSIVCPLCYCFDIQHIPKTKNKGIVKKTWSSCLLEEFTKITGNFVFRSGRVERVRQFIGHK… |
| A0A7C5HNN0 | 50-178 | None |
| A0A1V5GCW5 | 19-139 | None |
| A0A7V0JU83 | 121-243 | None |
| A0A3M2E9G7 | 49-138 | None |
| A0A2J6JCX9 | 18-139 | None |
| A0A2D6NUP9 | 70-190 | None |
| A0A7V1EK36 | 2-86 | None |
| A0A1V6JWZ0 | 3-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.