DPCstruct | MC39324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.61 |
| Pfam Score | 61.82 |
| Assigned Pfam label(s) | CL0451- PF15430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1T9E3 | 2-111 | FFKIVLVSLLFSQINGFCYKTFGRIDKTVSGRLIPVCEFNGLDILDGSTFSTAACTECVCNEGTLACCGYGINGGKVVAPPGCKTVA… |
| A0A482ZI90 | 15-117 | LCFLIFALCCLVPQFSADMRLQPMKVGYDDCIDDEFKAHPVGSRWYSKKKCEEHSCLFIKGILYVMQSGCGKVGYSPECKLVQGNKD… |
| A0A7J6ZTA5 | 139-251 | None |
| A0A6P8KYH3 | 3-86 | None |
| A0A139WBH4 | 11-101 | None |
| A0A139WBG6 | 123-225 | None |
| A0A1A9VWK9 | 44-127 | None |
| A0A1B0A1P8 | 2-99 | None |
| A0A6P8GZY7 | 1-101 | None |
| A0A1D2NHE2 | 11-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.