DPCstruct | MC39322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 101 ± 23 aa |
| Standard deviation of domain lengths | 22.75 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644XSG9 | 18-101 | YTVLDGFFSDYQHVQIVNLPDAPTIVVLASDGYPQLHPTLAATEEALELQLRQDPLMVSTFRATKPLIAGNLSFDDRSFLRIIV |
| A0A1H9GF85 | 106-208 | AREVIEPDLIQAMLEGQNKHYSVIDGFPICENNIKIVSTVNSHQIVLASDGYPFLKNTLKESESLLEQQLKNDPQNIRTFIATKGLM… |
| I0L1L7 | 20-116 | None |
| A0A352P2L1 | 1-80 | None |
| A0A1H4G8I5 | 24-137 | None |
| A0A5Q5G0T2 | 32-118 | None |
| A0A1G5HLN6 | 41-172 | None |
| A0A1V8QIT2 | 54-150 | None |
| A0A3A9GCY2 | 79-175 | None |
| R5FG38 | 40-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.