DPCstruct | MC3932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 289 ± 40 aa |
| Standard deviation of domain lengths | 39.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0CPB9 | 73-369 | FTLDEDRRFTNLILSEVDYNSYLDETGNVQDITKKVYEYFDDDFDFIIILSNEADQPPGLYFGRHTPAKLDVQGLGGNTYNNTQAFG… |
| A0A6B0WQ01 | 464-746 | SRPVSRSSWAQHEVFHHVHPKDHLIPLACRIIDALGDEFDLLVFHSQFRTDHQFNGSWWGYYPGNVPIKGIGQEEHHDRKSSCSARM… |
| A0A522DH45 | 2-263 | None |
| A0A2W1AFM7 | 315-583 | None |
| A0A800JAB1 | 2-242 | None |
| A0A3M1EMD5 | 114-313 | None |
| A0A0G1UQJ4 | 781-1074 | None |
| A0A3C1JIG3 | 306-627 | None |
| A0A3E1KAS5 | 12-293 | None |
| A0A2E8T946 | 230-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.