DPCstruct | MC39316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 133 ± 16 aa |
| Standard deviation of domain lengths | 16.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0I925 | 1-124 | MFNNISPKVLQTYASRAATEHPRELRWHPEPIRYTLVAAFCWLRLREVTDNLVDLLIRIIHGISRRAEKKVDTELIKDFKKVGGKTN… |
| A0A2K8RKD2 | 17-138 | FADVSEKLVDAWRARASKEYPANLERMKAPRRVTLLATLCHVRQTEITDSLVDLFIQLLLKINTRAERKVDKELDAELKKVRGKEGM… |
| A0A175M0X3 | 1-150 | None |
| A0A2T0MNK2 | 119-265 | None |
| T2J2D2 | 87-223 | None |
| A0A2K3US56 | 2-97 | None |
| A0A7W7SKT7 | 122-268 | None |
| A0A1H0RCK4 | 10-153 | None |
| A0A5D0PZL6 | 132-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.