DPCstruct | MC39311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 142 ± 20 aa |
| Standard deviation of domain lengths | 19.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P3VV36 | 1-132 | MYSFKYSFKPKFSNDSVSIDFNFDVEKSIPSRIFAIIGKNGTGKTQLITTLPLDISKKRDDAFTPKTPIFSKVIAVSYSAFDTFDIP… |
| A0A7H1J1C6 | 154-316 | LTNYQFSYVREGSESYSDIELEFDVTVESKPSTNIHAIIGRNGVGKTTLLNDMIKVVTRSPDSNGAFVDRSGARDREIDEEYFSSLI… |
| A0A0B6XDN2 | 3-116 | None |
| A0A151A3F8 | 148-281 | None |
| W7WCW1 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.