DPCstruct | MC3931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 177 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1TLF1 | 121-296 | FYLSDEAKALLNKNAFAVMPAYNDEFYPLYEDNRYNYLPSFITTDSILHNYHLVFDYLLKNLEEEKMFLELQTVNSQMLAESVKQYE… |
| A0A539DY81 | 13-195 | PELVAAIEGQGFAIRAGGAANFFHQIYEASSYDYETTFVTTDAMYNAWHNAFSKVLRDTETDVLVPALGDYLTRTVAAARGQADELS… |
| A0A0S8G8X8 | 39-204 | None |
| A0A1M6DZZ6 | 102-278 | None |
| R5QXD3 | 170-342 | None |
| A0A1F7RMK8 | 152-304 | None |
| A0A101GRV8 | 2-152 | None |
| A0A7H0XS47 | 81-277 | None |
| A0A265Q1L8 | 92-259 | None |
| A0A080Z8J8 | 103-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.