DPCstruct | MC39309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 225 ± 26 aa |
| Standard deviation of domain lengths | 26.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3F229 | 4-228 | SKQWKLQRMDHVLVNALEKRLQESQPYPGDTVPPNPYMRFTVWRSRTEPNNYQFIDHDRYLGGEITLDKLLNPLFEPGHFWAYELAK… |
| A0A4Y7SX73 | 665-838 | EDPIRERVDCLLQRGAPYKQDSFKGVFDDDRFLIYRTEGGYAIMDDMYTDAEPLYISWDKARNPNFNIVGWYQKRLNKIFDVPGGKR… |
| A0A4S8L4Z3 | 1-263 | None |
| A0A2H3EWC9 | 123-325 | None |
| A0A4S8KX63 | 174-442 | None |
| A0A284RSQ3 | 117-368 | None |
| A0A0C2XYT3 | 137-327 | None |
| F8NEG6 | 28-248 | None |
| A0A4Y7SA39 | 122-320 | None |
| A0A2H3IVG2 | 277-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.