DPCstruct | MC39308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 192 ± 28 aa |
| Standard deviation of domain lengths | 28.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8LZH8 | 3-125 | VAAVLNSLQVQSILMGQHGGTPRLYWNLYLTPPTHHIRHYEEWINLIRSIVFRTALYGTGTSIEVPFRCSRCGAIDHPAGHCPFPEV… |
| A0A2H3JHN4 | 184-407 | GGSEWLRDFLAYQQTFAIDKTLTFSIMKFEPAQFLWIIANFSGDSVLCEAEGAILTAVKRSLWYHDEFRFLIDKILTKNGVPGTVND… |
| A0A2H3C3S1 | 181-357 | None |
| A0A146H8V2 | 43-242 | None |
| A0A0C9TS58 | 219-398 | None |
| A0A0C9TX55 | 100-283 | None |
| A0A0C9UIH2 | 319-484 | None |
| M2RCJ7 | 668-859 | None |
| A0A5C3PGS0 | 783-993 | None |
| A0A0D7A711 | 350-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.