DPCstruct | MC39301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 141 ± 16 aa |
| Standard deviation of domain lengths | 15.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0063- PF02277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447PFS7 | 2-112 | ARAQQHIDGLLKPPGSLGRLETLAVQLAGMPGLNGTPQVGEKAVLVMCADHGVWDEGVAVSPKIVTAIQAANMTRGTTGVCVLAAQA… |
| A0A7J0CJY7 | 156-300 | HDLLQETISAIRPLDAKALGEAWERQKRMTKPAGALGMLEIISAQLSGLSRMCPPPIPEPAAVAIFAGDHGVHAQGVTAWPQEVTAQ… |
| A0A0P9CDL8 | 2-155 | None |
| A0A2T0PXJ2 | 399-526 | None |
| C9LWY2 | 32-184 | None |
| A0A377ZCC1 | 1-144 | None |
| A0A5B8MBZ3 | 411-568 | None |
| A0A2Z3HE96 | 1-147 | None |
| A0A4R3K2T4 | 1-176 | None |
| L1IL39 | 14-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.