DPCstruct | MC3930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 8.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349BBA5 | 8-107 | RRCRWCARRFTVTVGPGRPREFCRRSCRQRDYEARQRASEVGLSEHELVLTRQAMDDLRDRLYVLECAVEDVERDLVGAPTRAEYRE… |
| A0A539DUM6 | 2-108 | RRCRWCRIVLAPGRSGRRQGPGRPREFCSQRCRQWDWVSRQRARELALSDGELVMARGELDSLHDDLYVLSCAVADAQRDLEDEMTL… |
| A0A1H9XDU7 | 1-105 | None |
| A0A1Q3PYB8 | 1-93 | None |
| A0A6I3I718 | 2-101 | None |
| A0A5J6IQJ8 | 1-116 | None |
| A0A1Q9LPJ9 | 4-109 | None |
| A0A426Q9Q6 | 1-101 | None |
| A0A285V630 | 16-127 | None |
| A0A1U3HC58 | 31-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.