DPCstruct | MC393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 93 ± 17 aa |
| Standard deviation of domain lengths | 16.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7RDN5 | 1-86 | MPPLVEAFHARELTSHINHLPDGKTRKPPVSDLKKCDLKELVQYNCELNGPKEDKRSKIVCDPVLRLFRQCANGLTVETTAWEGRF |
| A0A0D2GVP2 | 1-110 | MAPPEHPFPVSELDQHVRSLTVNYKEKSRKLPQDFDLKRDCELMELVQYTCTTPKQQYERALASGTGTARIECYPIVRLFRKCVKGG… |
| A0A3M7D937 | 71-153 | None |
| A0A0F2MAG6 | 1-151 | None |
| A0A370TU88 | 1-90 | None |
| A0A6G1HWP9 | 6-84 | None |
| A0A381LBL3 | 17-98 | None |
| V9DFW6 | 1-99 | None |
| A0A3N2PQ16 | 1-93 | None |
| K3VXW4 | 54-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.