DPCstruct | MC3929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19670 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6V0J7 | 6-101 | QVPVLKSIPEYAFDALVEEMKRFQTRLSDETELGIVANGPGLTIHVDDLRLSGQMVVFDGVDSEGRAARLIQHYTQVNVQMVAVPKQ… |
| A0A2K2TT22 | 6-101 | ARQAFSNIMAQIDAFQENLDDDKEVAVLLASFGSSLLMTVTGIGFQNPELVYFYGYVDGKPSQLIQHVTQINFLLTSVDKEDPEKPP… |
| A0A2S7TXV7 | 1-90 | None |
| A0A5C6S5M2 | 65-172 | None |
| A0A2N6DR74 | 2-82 | None |
| A0A355S639 | 13-112 | None |
| Q4FT07 | 82-181 | None |
| Q01QD5 | 19-127 | None |
| A0A2N5KIP6 | 4-112 | None |
| A0A2T5BUF1 | 31-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.