DPCstruct | MC39281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0V547 | 1-65 | MRGKRVVLSRPDGFVYDVRAVSELDRDADGRQVVRVVTEEAYFRWMFTGVAASAESYPARLVWVE |
| A0A7J9ZFS1 | 2-104 | TTLRGYIDPRQVAVAPPARTPRPVPFEATVLGARVVLILVDDVTGRSRYLRDYRATSEVVTDGAGTRVVGVAPERDWYAWSLASRDG… |
| A0A6G8Q7F1 | 1-80 | None |
| A0A6F8Y2Q7 | 44-134 | None |
| A0A1G8EG32 | 1-94 | None |
| A0A1H1L5N4 | 24-116 | None |
| A0A7J9VJX5 | 43-137 | None |
| A0A6A7MKG3 | 1-90 | None |
| A0A6J4JIQ7 | 98-193 | None |
| A0A7Y0DH24 | 198-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.