DPCstruct | MC39278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 76 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9YZG6 | 2-84 | GVTVFALTVAAVAQELNKPAGDRTWTGRVGGLVPYDLRWPVTAERLRAAMWNPDSDAVFTPHAFGVGWSLNLARVASLTRGAL |
| A0A4R0K349 | 5-57 | TGKFLGIPYDWRRPTLDRTRSRWWNPAEPRLFTPKVLGWGYDVNFARLFGRHP |
| A0A7W0YFI5 | 2-55 | None |
| A0A1D8S6V8 | 2-63 | None |
| A0A022L3L6 | 1-83 | None |
| A0A6G7Y2L2 | 83-140 | None |
| A0A2W5ZCK6 | 5-90 | None |
| A0A8B5XK32 | 9-90 | None |
| A0LW29 | 51-134 | None |
| A0A535V8R1 | 4-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.