DPCstruct | MC39277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Standard deviation of domain lengths | 20.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7HL62 | 3-105 | VEGNALRTVLNLAKGERSSVFRVSPRLRNSVLSWYLRLRDTTGHDALWGLVRIEMSECENPGDRADEISRWVLAETSPLALPDGRWD… |
| A0A6J4LTD1 | 25-137 | RTLYADGDALRAVLALRRGHRSSVFRIAAPRRAPVASWYLRLRDPAGRDPMWGLVRIEAADRRAAERPHELTARADLISRWVLAEVS… |
| A0A6B1GL84 | 114-249 | None |
| A0A2V7KVX4 | 115-247 | None |
| A0A2V7JEF0 | 142-255 | None |
| A0A7Y2JPR7 | 15-144 | None |
| A0A522VMJ4 | 112-272 | None |
| A0A7Y3G0H0 | 45-194 | None |
| A0A6N8V928 | 66-215 | None |
| A0A7V9ZVA6 | 94-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.