DPCstruct | MC39276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 421 |
|---|---|
| Mean domain length (aa) | 168 ± 26 aa |
| Standard deviation of domain lengths | 26.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 13.65 |
| Pfam Score | 99.22 |
| Assigned Pfam label(s) | CL0044- CL0061- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4KXX2 | 131-293 | TTAGAGDHHDGRGTMGTSATSDSAALLAELNDLLQLDRDAVQAYTLAEQGLESEEYKAAIRRFRGDHERHIRELERLITARGGTPAS… |
| A0A316SVC7 | 15-163 | VAKVLDELNVALSEEWLAFYQYWVGALVVKGAMRADVQGEFEEHAMEEFAHAKLLADRIIELEGVPVIDPKEWFNLAKCAYLPPTDF… |
| A0A509EAS1 | 2-173 | None |
| A0A0D2PAQ8 | 30-222 | None |
| A0A7M5VFX4 | 47-192 | None |
| A0A1R4FHV6 | 1-145 | None |
| A0A1I3UUS7 | 1-151 | None |
| A0A6P1TKK7 | 22-160 | None |
| F1VVE5 | 2-138 | None |
| A0A254TFQ7 | 28-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.