DPCstruct | MC39270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 141 ± 28 aa |
| Standard deviation of domain lengths | 27.51 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5X5K4 | 256-394 | AQHFATLALEWYNSTKKTHKFEIAKVLFSKCFTDVDHNTYAHVNFTATPTSDSHLPKRLFFAELMLVPNLQACKDTDPIRVLSVSAI… |
| A0A835AM08 | 14-160 | PHDLWVNPKVELAKAKRFATGVLEHYNKRKKIKFELLDARPVTSIPEPRCCYTHINFTAKSSKEDSQEQLFFAEIYHCRKRRHPHGF… |
| A0A0D9XM66 | 48-147 | None |
| A0A0D9XM67 | 78-209 | None |
| A2Z9T7 | 51-161 | None |
| A0A0D9XWX5 | 12-139 | None |
| A0A446IM28 | 11-139 | None |
| A0A1B6PGV1 | 81-271 | None |
| A0A453DNF9 | 304-508 | None |
| A0A287HR04 | 2-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.