DPCstruct | MC3927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 5.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286CR74 | 2-59 | VHAPALDGSRRVTLGEEPLGLATHTDDVAEILRLADLYVTDVAESDLVEWQGGGPDEW |
| A0A6G7T695 | 12-78 | HGECAPARICPPSSTGGRPATLGGVALGVADSPADVVRLLRQAGLDDSLICLDDQSLIDWEGGGPDV |
| A0A1C4IG29 | 44-115 | None |
| A0A7G1NB65 | 50-120 | None |
| A0A0P4R6L3 | 94-160 | None |
| A0A6I5CZP5 | 1-60 | None |
| A0A5P9WDF7 | 1-66 | None |
| A0A344UAG2 | 1-69 | None |
| A0A1Y2NMC5 | 26-96 | None |
| A0A3N1KQI8 | 248-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.