DPCstruct | MC39269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RYF1 | 62-128 | PKMYQLDQIIGVAKASEAYKLGDTNVEVVLRVANYWKDVHISMLSDDYFEEEECEALQQLVKKGLFK |
| A0A835AJT6 | 1-88 | MVAQPVHSYVKSTKAFVLGRVTGIKRASEEYKAKGTCTSTNILLCVTGLWADVKISMLSDNDIEEDECSVLNSSVKEGLLERATICVS |
| A0A426ZWT7 | 398-478 | None |
| A0A6V7NI20 | 2-73 | None |
| A0A1D6FQ05 | 1-78 | None |
| A0A1D6FPZ4 | 190-284 | None |
| A0A1D6N5D7 | 301-384 | None |
| A0A368RE98 | 392-465 | None |
| A0A0E0L2P1 | 382-470 | None |
| B4FKI0 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.