DPCstruct | MC39266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0JE80 | 46-137 | MLRMTPLHKELSLRTEAIIVATLYKMLKANGMHQWVVFQEHKSTIKKSIDDLKQTLLRYKSNRIKLGLFYLVPRKDGKIGFIVRSPL… |
| A0A835A7G3 | 1-90 | MVKYNYLYRELLLRYEARKITGIFFLLKEKGMFNWEAYKEHRESIKNSFDILRNALARYKDRRIKAGYFYMCNHQRLHAVYVMSPLY… |
| A0A1E5VIP2 | 1-100 | None |
| A0A0E0H7K2 | 32-123 | None |
| A0A0E0H753 | 65-178 | None |
| T1N203 | 1-92 | None |
| K4A301 | 28-126 | None |
| A0A835EIP9 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.