DPCstruct | MC39261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 186 ± 25 aa |
| Standard deviation of domain lengths | 24.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418NI65 | 61-246 | EEETQDADHLSVDEVRETIRQLGKSDAAKIRQAACWFECRCGMPADDLMQEAFVRMVSGSRRVPRGPHFVAVVVQIIRSIASAEIDA… |
| A0A2S8RPA0 | 4-203 | KQTLQVAPQALGNATSTEIYAAYAALTDDDWRELNKTGRWLLGGTEFSETFDLINEAIERMASGRRAWRLTVAFPIALAMCMKSIAS… |
| A0A2N3BAM7 | 28-220 | None |
| A0A1L3FRS4 | 4-147 | None |
| A0A430FXK0 | 4-141 | None |
| A0A1D2RNC6 | 18-225 | None |
| A0A370U8M8 | 1-223 | None |
| A0A7Y7LAG0 | 1-187 | None |
| A0A2V8XB08 | 114-302 | None |
| A0A521Q198 | 5-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.