DPCstruct | MC3926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4M460 | 317-398 | SNPPTDKQLEYAQKLSKRQNVEIPKEAMQNKDAMRQYLHDHTPRPSNKQISYAASIAKRINIGLPDKIRTDTKVMKRFLNEH |
| A0A109ECM5 | 212-337 | QPAAPVAPARPVRPAPAPVDGPSAPMLNYMQSLARSLGWSLPPEALKVRRVASEFIDKAKAAVQARGAATGRTTIKTPTKVGGAPFP… |
| A0A0M0KAC9 | 1-94 | None |
| A0A258G3V7 | 1-96 | None |
| A0A7S2MDI0 | 98-196 | None |
| A0A1Y5TLP0 | 4-110 | None |
| A0A352FIE8 | 37-137 | None |
| A0A7S4UWG2 | 48-147 | None |
| A0A7S0DX92 | 6-118 | None |
| A0A7Z1UZA9 | 93-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.