DPCstruct | MC39256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05630 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842Z2M5 | 1-109 | MHKSLFTTAAAALFGVLAVARPEGSRLKSRDIIKAIPEGASPRELKFKPWTDYDTDSCYNTAAVSEDGTANPGTGPTTTFQGNCRDP… |
| A0A2T6L0U1 | 43-168 | PRPSARRPARLVAALAAALLALAAPAAAAHADPPPNLPQNASGYEQSFSPAYDYDTDGCYATSAIGPDGTLAPGLALGGAVNGQCRD… |
| A0A3N2QA87 | 63-172 | None |
| A0A2H3S3R8 | 1-133 | None |
| A0A139AGC6 | 1-108 | None |
| X0BTT6 | 1-115 | None |
| A0A2D3UMM0 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.