DPCstruct | MC39252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 121 ± 10 aa |
| Standard deviation of domain lengths | 10.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842YW88 | 4-112 | RVTKVLYNLPDCDCSAGESAGELVSAEGGLERYKEEFIKPYAEKLSAATDLTFAVVLEPDSLANILTNSETIPFCAEAGPVYEEGIA… |
| K9G2R5 | 57-169 | VVYDLPDRDCAALASNGEFSIANGGVANYKAYIDAIREVLVEYSDVQTILVVEPDSLANLVTNMAVPKCAGAHNAYLECTDYAVTQL… |
| A0A4S9MHS5 | 22-139 | None |
| A0A0D3MDW1 | 747-869 | None |
| A0A813EZL4 | 221-361 | None |
| A0A842YWT4 | 3-120 | None |
| A0A7S2JPQ8 | 81-221 | None |
| A0LSH8 | 118-238 | None |
| A0A3N4IW26 | 19-136 | None |
| A0A3N5S7J0 | 514-636 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.