DPCstruct | MC39251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842YVS2 | 12-136 | VGARSSSVTHLHPSPIHIFQLWQVYINNINPLLRITHVPTAQGRVIEASANLERTPMGLEALMFAVYLMALISIDDAEVQVMFGEPR… |
| R1EY82 | 24-153 | PSDVFWQTDHRSFEPLIYAPPARQIPWYWEKFIELVDPFVKILHIPTTAPLFLNFNASTTPVDTQPLFFAICYSVACSLPPSVCATV… |
| H0EFF5 | 41-172 | None |
| G2Q5N8 | 7-132 | None |
| A0A0C4DJC8 | 171-306 | None |
| A0A2U3EG97 | 1-120 | None |
| A0A1B7P0L5 | 136-281 | None |
| A0A842Z3K1 | 2-117 | None |
| A0A1L9TL33 | 369-504 | None |
| A0A6G1NUJ0 | 78-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.