DPCstruct | MC39248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 563 ± 80 aa |
| Standard deviation of domain lengths | 79.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811XAB4 | 80-644 | NALANIAANVRGTGARLELLTRLLELFVQLGLGGERATDREPAPVLKASGSAGNLGVLIPVIAVLVKRLPPIKNPKPRLHKLFKDFW… |
| A0A842YV29 | 104-561 | KWVNELRIMAVHSPPLVAEQRGEQVESDIELNTVLRRGMTTERDLMQKKHLSDLLPSKASDIRNLSYRKVIFLQAAYLVESLRADAG… |
| A0A6V7PP44 | 32-543 | None |
| A0A498SEZ0 | 1-543 | None |
| A0A446RRV1 | 268-927 | None |
| A0A7J9BS69 | 18-528 | None |
| A0A2G9V3P2 | 2-512 | None |
| A0A2W1BGQ8 | 1-455 | None |
| A0A6A4V1X6 | 4-586 | None |
| A0A3P7EVW6 | 553-1164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.