DPCstruct | MC39242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 279 |
|---|---|
| Mean domain length (aa) | 187 ± 33 aa |
| Standard deviation of domain lengths | 32.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842YEZ9 | 2-190 | KQIFVDGFFHGDPHPGNLLVTDDGRVVFLDFGMVGILRPERRLTYTRIIYAIISNDINMLLDSFDDIGIGVPPELVEDFKDEMYAIF… |
| A0A7S2Z3G5 | 1-134 | IGLIDYGQVKALGERERRRYAKLILHLASGDRRATVAHATGEMGLRTRHMKEDVIYKLLCFFHDRDTDDVTGGRNIQNFMDWANAED… |
| A0A1Q9CEC5 | 1-248 | None |
| A0A4R2JPL1 | 262-464 | None |
| A0A7S2UDE3 | 37-259 | None |
| A0A7S0M256 | 1-114 | None |
| A0A5S6QT58 | 708-824 | None |
| A0A287XH62 | 79-272 | None |
| A0A849WRD7 | 495-690 | None |
| A0A4V5NDD4 | 598-806 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.