DPCstruct | MC3924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 97 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11745 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6U9J1 | 76-164 | WQPDLRLTVRWLAYRKQDHTTNWYKAENVRIAKYGEVMGGLWAVFLPGDRVRIMVADGQRGGANDPGIRPQDNDPYIAQGALDPEWN… |
| A0A088UKV0 | 1-91 | MRWLVDKKQDGKTPGDWYKAENVRIPKYGKVMGSMWAVFLPGDRVRIMVADGRKGDANDPDIHPSDNDPYIAQGVVDEEWNRLYRDG… |
| A0A6P3AQP5 | 2-99 | None |
| A0A6P3A455 | 223-323 | None |
| U3G7V6 | 1-97 | None |
| A0A1W1Y1D2 | 86-181 | None |
| B1T8J6 | 4-92 | None |
| A0A1K0IJG7 | 5-101 | None |
| A0A6J5AC54 | 52-151 | None |
| B2SWT3 | 175-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.