DPCstruct | MC39237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 397 |
|---|---|
| Mean domain length (aa) | 256 ± 58 aa |
| Standard deviation of domain lengths | 57.55 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 86.32 |
| Assigned Pfam label(s) | PF03798- PF18913- CL0492- CL0182- CL0171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0L7G0 | 22-295 | KEKKQAKVFLEIMTEVGNTLLEEREACKEAGEVSHDKVRSIDIQITNQLCDRISQHPDLCDVFCSEDKEPEVFSGENMRDAQKFVLV… |
| A0A2I0I6K0 | 3-168 | IFGPRTTYVLALKDAPGTHEFLLLDEGKWQHVKDTTEIGEGKMFSPGNLRATTDNPNYAKLIDYYIKEKYTLRYTGGMVPDVNQIIV… |
| A0A6P5N8K1 | 5-219 | None |
| A0A561V8L9 | 302-533 | None |
| R1BRW9 | 58-423 | None |
| A0A5C1WN05 | 60-304 | None |
| R1CWK8 | 10-271 | None |
| M7Z581 | 28-322 | None |
| A0A194XA16 | 100-445 | None |
| A0A7S4P3B8 | 104-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.