DPCstruct | MC39236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 377 ± 29 aa |
| Standard deviation of domain lengths | 28.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M6W689 | 113-501 | TTEEKPEKEVVFDGVFDPEAELVVIKKLPHQERKQAVEIFKEKLAAQKEGLAKMQTQLIEYVRINPDASFEELVKKAEDLGSPYGMS… |
| A0A554IWZ1 | 32-434 | APEKESPIKPGEIFDPEDELRKTLKFSGKEKEERFAEYKEKYRYQREGLAEMEVALRDFIVENPDSPAEELISRANSFFIKYGFSVK… |
| A0A1F8F7Y7 | 2-328 | None |
| A0A1F6WZ43 | 53-414 | None |
| A0A554LAH5 | 17-382 | None |
| A0A1F6W5L5 | 3-349 | None |
| A0A2H0TWK1 | 1-337 | None |
| A0A1F4VA15 | 8-397 | None |
| A0A0L0LHH1 | 1-400 | None |
| A0A2J0HNW9 | 284-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.