DPCstruct | MC39231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 140 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07587 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3C555 | 321-470 | VNQVWQEYFGRGLVKTSGDFGMQGELPSHPELLDWLAVDFMNHGWDIKRLVKQIVLSATYRQSAVVDPDKFNVDPDNIFLARAPRYR… |
| A0A3C0WJI7 | 193-338 | VNRIWMQHFGEGIVRTVDDFGWAGDSPTHPELLDWLAVEFQESGWDIKNLHRLILNSRAYRQQSAMDTPESEGAATLDPTNKLIWKQ… |
| A0A3L7VKK3 | 585-721 | None |
| A0A6N8WM02 | 585-729 | None |
| A0A7V5UKR2 | 159-308 | None |
| A0A7C7SEA9 | 736-886 | None |
| A0A517T3B9 | 973-1103 | None |
| A0A355G7B3 | 338-490 | None |
| A0A388PBP7 | 65-175 | None |
| A0A2A2Y8P6 | 217-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.