DPCstruct | MC39225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 541 |
|---|---|
| Mean domain length (aa) | 99 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.01 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | CL0023- CL0136- CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1DIC9 | 180-294 | EPAATGLWGTVVWAVDASGKAPAYEYFRDLDDKDAAKMQALFNRLARDGFIKNDEKFKKLYDRNLREFKSFQLRFLGNYTKGRQFLV… |
| A0A2V8ZUN4 | 17-115 | QAHRQPAFELRYTPDAAADIKALDGSVRNQLRKVLEKKLAIDPEGYGLPLRGSLAGYWKHQFGNHRVVYRIYSQHHVVVVCSVGVRK… |
| A0A2S2CRA3 | 1-109 | None |
| A0A1V5XB93 | 2-114 | None |
| A0A3D1R8V7 | 76-191 | None |
| A0A0G1XNH9 | 1-88 | None |
| A0A522ZXI4 | 9-138 | None |
| A0A7I6XSB9 | 2-116 | None |
| A0A7H1N5U0 | 5-101 | None |
| A0A7V2PTV4 | 5-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.