DPCstruct | MC3922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 321 ± 85 aa |
| Standard deviation of domain lengths | 85.17 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8VIU2 | 99-296 | HQRFDEFFLELLENTERSLNEMFVRTYGKPYMQNSEVFENLFSELKRYYTGGNVNLEEMLNDFWSRLLERMFTLLNSQYVITEDYLE… |
| A0A671MPN0 | 23-342 | IWSWESPTEFFLELLDNSEKSLNDMFVRTYGKLYTHNSEMFEDLFSELKRYYTGGNVNLEEVLNDFWSRLLERMFQLLNSQYTFTDD… |
| A0A452VMW9 | 2-180 | None |
| A0A4Z2HP75 | 11-366 | None |
| A0A3Q0JBA6 | 64-355 | None |
| A0A482WSX6 | 3-225 | None |
| A0A835NMR8 | 115-485 | None |
| A0A556TK83 | 6-234 | None |
| A0A4Z2DCP1 | 29-324 | None |
| A0A0X3P9B9 | 59-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.