DPCstruct | MC39215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 18.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02919 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4MZB7 | 11-121 | VKWKFLEHKGPYFPPEYQPLPDHVHFYYNGKKVKLSLAAEEVALFFAQMLDHEYTTKKVFRENFFKDWRKEMTHEERSLIQDLDKCN… |
| A0A4P9X2X7 | 18-125 | HNGPMFPPLYEPHGVQMRYNGQPVALSPASEEVATFFAGVLDAEQGSNPVFCKNFFTDFLAVIRANDPPSCPIRSFELCDFRPIRNH… |
| A0A0F9B309 | 1-107 | None |
| A0A095C692 | 91-242 | None |
| A0A3R7YIW8 | 125-257 | None |
| A0A7J6Q4M3 | 48-200 | None |
| A0A0C2J5J7 | 51-201 | None |
| A0A453RXP8 | 378-512 | None |
| A0A6V7W815 | 144-296 | None |
| A0A2I0L9U3 | 308-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.