DPCstruct | MC39213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B6Z6A9 | 4-131 | YEQPVKQRINMAHGFMKSVIRNQIDRDNYDKEIKARQQHGRPHIKSSHGKSKKPEIQTYIPPQRSKKESSQHMFVLEYEHKSGEVYT… |
| A0A3Q4MGT1 | 4-158 | LREEGVHELKYKPGGRLDMSHGFLHHIRRNQIADDYDKEVKQAKELQRRRHTTTPRRPRRPDMQVYHPRRRPGAGADAEENESGSST… |
| A0A6P8I0C1 | 1-139 | None |
| Q4V817 | 2-151 | None |
| A0A6I8P4U3 | 150-276 | None |
| A0A6I8RIU1 | 2-184 | None |
| A0A803TXH3 | 31-161 | None |
| A0A7J7K3J0 | 3-149 | None |
| A0A402EJ37 | 11-168 | None |
| A0A6P8RJ16 | 24-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.