DPCstruct | MC39212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 154 ± 27 aa |
| Standard deviation of domain lengths | 26.83 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.00 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | PF05873- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4IBS1 | 1-135 | MAGRRAALKAIDWAAFAERVPPNQRTMFNNLKTRSDAILLCVHRLTSLPEKPPAIDWSYYRSVVAKAGMVDEFEKKFSALKVPEPVD… |
| B4J7G6 | 16-186 | KVCNKVSLTDLFNRVPPNQHKQLRVFANKNEEYKIRLRKYPPDLPRIDWQFYKENVRTDMVGWVEEFEHKYDKLDSMFANRHNLIDH… |
| A0A5S6QG90 | 2-137 | None |
| A0A5E4APR4 | 1-123 | None |
| A0A4C1TZK5 | 1-112 | None |
| A0A6P8AXY8 | 31-205 | None |
| A0A6I8P5J5 | 4-106 | None |
| A0A0V0ZTI4 | 1-190 | None |
| A0A261Y0U8 | 185-352 | None |
| A0A671F0I3 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.