DPCstruct | MC39210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 122 ± 22 aa |
| Standard deviation of domain lengths | 22.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645C9X0 | 7-108 | AGIEEEGLNYRFVKIYRTSDVCFVAHDAAELSGSGVGIGIQSKGTTVIHQKDLFPLSNLELFSQAPLIDLPTFRAIGKNAAKYAKNE… |
| A0A448VYT2 | 71-213 | VVVAVSPAFSTLIHETIIGLPHAAVLKEIAAGIEEEGLKHRFVKVYKTADVGFIAHQAAKLSGSGIGIGIQSRGTTVIHQKDLPPLS… |
| A0A2G6GG45 | 12-122 | None |
| A0A377XGT6 | 2-94 | None |
| A0A2Z3V9F5 | 51-121 | None |
| A0A3L7W051 | 570-718 | None |
| A0A1R0V9V9 | 7-103 | None |
| A0A2X2TW75 | 19-173 | None |
| A0A848CW33 | 4-116 | None |
| A0A7G9W5P4 | 7-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.