DPCstruct | MC3921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 139 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 60.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15156 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A480ZG85 | 111-244 | LGHSLWYIPFFLILFMYFSGCFTPTKTESVMPGAALLLVVPSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKRKRLFLDSNGLFL… |
| A0A671MDA8 | 20-154 | CSVASTRWYVPFFLILFLYFTGCFTQVKDEKMPYSGWLLLGPSAVYYWYLITEGQIFVLYVFTFFAMVATVMCQRWMGFVLDSNGRF… |
| A0A1A8A677 | 84-217 | None |
| A0A3Q3XEA2 | 61-200 | None |
| A0A3B4VG87 | 138-282 | None |
| A0A674H0Y6 | 618-748 | None |
| A0A3P8QY89 | 6-151 | None |
| A0A6J3QZE3 | 256-389 | None |
| A0A814C3D2 | 62-191 | None |
| A0A667G0H3 | 88-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.