DPCstruct | MC39205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 10.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M4D539 | 1-89 | MLISTNQTRHTEFGYLPVTNKIKGADLSEDQRLRLGAGEKVLVEKMVSRTDHFFDRYIQINASDKKFDFTYEGLDRNRCSKVNKEVC… |
| W4UWT2 | 484-568 | QYSRTPDGFNERQAPVVPAEVYGHVFSAQERANLQDGKTILVSDLKGANNKAFGSYLKVNANSGQLQYFQDNPDIRRDTSRRAAQ |
| A0A7Y0UMW6 | 1-102 | None |
| A0A5N7Z989 | 318-408 | None |
| A0A5E8K697 | 4-91 | None |
| A0A1I1EGT2 | 352-417 | None |
| W5J2E7 | 101-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.